CoraLite® Plus 488-conjugated ADC Monoclonal antibody

ADC Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67884
Clone No.1A2B11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

AZIN2, AzI2, Arginine decarboxylase, ARGDC, Antizyme inhibitor 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67884 targets ADC in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31049

Product name: Recombinant human ADC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 251-460 aa of BC028128

Sequence: EIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM

Predict reactive species
Full Name arginine decarboxylase
Calculated Molecular Weight 460 aa, 50 kDa
Observed Molecular Weight48-50 kDa
GenBank Accession NumberBC028128
Gene Symbol ADC
Gene ID (NCBI) 113451
RRIDAB_2923815
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96A70
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Antizyme inhibitor 2 (AZIN2) is a member of the antizyme inhibitor family, witch is able to bind to AZs and inhibit their action on both ODC activity and polyamine uptake. AZIN2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of azin2 has also been observed in brains of patients with Alzheimer's disease (PMID: 19832840) . AZIN2 has 5 described insoforms produced by alternative splicing. The molecular weight of AZIN2 is about 50 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 ADC antibody CL488-67884Download protocol
IF protocol for CL Plus 488 ADC antibody CL488-67884Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...