CoraLite®594-conjugated ADC Monoclonal antibody

ADC Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67884
Clone No.1A2B11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

AZIN2, 1A2B11, Antizyme inhibitor 2, ARGDC, Arginine decarboxylase

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67884 targets ADC in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31049

Product name: Recombinant human ADC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 251-460 aa of BC028128

Sequence: EIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPILQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGVCKPLSCGWEITDTLCVGPVFTPASIM

Predict reactive species
Full Name arginine decarboxylase
Calculated Molecular Weight 460 aa, 50 kDa
Observed Molecular Weight48-50 kDa
GenBank Accession NumberBC028128
Gene Symbol ADC
Gene ID (NCBI) 113451
RRIDAB_2934784
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ96A70
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Antizyme inhibitor 2 (AZIN2) is a member of the antizyme inhibitor family, witch is able to bind to AZs and inhibit their action on both ODC activity and polyamine uptake. AZIN2 is predominantly expressed in the brain and testis and localized in the endoplasmic reticulum-golgi intermediate compartment. Available data suggest its role in cell growth, spermiogenesis, vesicular trafficking and secretion. Accumulation of azin2 has also been observed in brains of patients with Alzheimer's disease (PMID: 19832840) . AZIN2 has 5 described insoforms produced by alternative splicing. The molecular weight of AZIN2 is about 50 kDa.

Protocols

Product Specific Protocols
FC protocol for CL594 ADC antibody CL594-67884Download protocol
IF protocol for CL594 ADC antibody CL594-67884Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...