CoraLite® Plus 488-conjugated AIFM2/ FSP1 Monoclonal antibody

• 

  FC experiment of K-562 using CL488-68049

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human AIFM2 (CL488-68049, Clone:1A2B2) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

AIFM2/ FSP1 Monoclonal Antibody for FC (Intra)

Cat No. CL488-68049

Clone No.1A2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FC (Intra)

Synonyms

AIFM2, AMID, FSP1, 1A2B2, AIFM 2

---

Tested Applications

• Positive FC (Intra) detected in: K-562 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68049 targets AIFM2/ FSP1 in FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30516

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2923870
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.