CoraLite® Plus 488-conjugated AIFM2/ FSP1 Monoclonal antibody

AIFM2/ FSP1 Monoclonal Antibody for FC (Intra)
Cat No. CL488-68049
Clone No.1A2B2

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

FC (Intra)

AIFM2, AIFM2/ FSP1, AMID, Apoptosis inducing factor 2, FSP1, p53 responsive gene 3 protein, PRG3, RP11 367H5.2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inK-562 cells
Positive FC detected inK-562 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68049 targets AIFM2/ FSP1 in FC (Intra) applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30516

Product name: Recombinant human AIFM2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-373 aa of BC023601

Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

Predict reactive species
Full Name apoptosis-inducing factor, mitochondrion-associated, 2
Calculated Molecular Weight 41 kDa
Observed Molecular Weight41 kDa
GenBank Accession NumberBC023601
Gene Symbol AIFM2/ FSP1
Gene ID (NCBI) 84883
RRIDAB_2923870
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BRQ8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 AIFM2/ FSP1 antibody CL488-68049Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...