CoraLite® Plus 488-conjugated AIFM2/ FSP1 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated AIFM2/ FSP1 Monoclonal antibody (CL488-68049)

AIFM2/ FSP1 Monoclonal Antibody for FC (Intra)

Cat No. CL488-68049 Copied!

Clone No. 1A2B2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF, FC (Intra)

Synonyms

AIFM2, AMID, FSP1, 1A2B2, AIFM 2

• 

  FC experiment of K-562 using CL488-68049

  1X10^6 K-562 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human AIFM2 (CL488-68049, Clone:1A2B2) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AIFM2/ FSP1 in ?

Chat with Able

---

Tested Applications

• Positive FC (Intra) detected in: K-562 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68049 targets AIFM2/ FSP1 in IF, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30516

  Product name: Recombinant human AIFM2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-373 aa of BC023601

  Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC023601
• Gene Symbol: AIFM2/ FSP1
• Gene ID (NCBI): 84883
• RRID: AB_2923870
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BRQ8
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The human AIFM2 protein (also known as FSP1 or AMID) is an apoptosis associated flavoprotein with a 6-hydroxy FAD cofactor. AIFM2 is a NAD(P)H-binding oxidoreductase with some sequence similarities to A1FM1 (formerly known as AIF, Apoptosis Inducing Factor), a mitochondrion-associated enzyme which relocates to the cell nucleus during apoptosis and is considered to be a key player in the progression of cell death.

Publications

What published studies show

CL488-68049 is the AIFM2/FSP1 Monoclonal antibody (1A2B2). It has 1 citation, published in Cancer Cell (2025). The study investigated macropinocytosis in maintaining cancer-associated fibroblast (CAF) subtype identity under metabolic stress in pancreatic cancer, using the antibody for immunofluorescence (IF) in mouse samples. The research field encompasses tumor microbiology, metabolic regulation, and pancreatic oncology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cancer Cell; Macropinocytosis maintains CAF subtype identity under metabolic stress in pancreatic cancer; Authors - Yijuan Zhang