CoraLite® Plus 555-conjugated ALDH1A1 Monoclonal antibody

• 

  IF Staining of A431 using CL555-60171

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using CoraLite® Plus 555 ALDH1A1 antibody (CL555-60171, Clone: 1A10A2 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

ALDH1A1 Monoclonal Antibody for IF/ICC

Cat No. CL555-60171

Clone No.1A10A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

Synonyms

1A10A2, 3-deoxyglucosone dehydrogenase, ALDC, Aldehyde dehydrogenase 1A1, ALDH 1A1

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-60171 targets ALDH1A1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8551

  Product name: Recombinant human ALDH1A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 153-501 aa of BC001505

  Sequence: TYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS

• Full Name: aldehyde dehydrogenase 1 family, member A1
• Calculated Molecular Weight: 501 aa, 55 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC001505
• Gene Symbol: ALDH1A1
• Gene ID (NCBI): 216
• Conjugate: CoraLite® Plus 555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 554 nm / 570 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P00352
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ALDH1A1(Aldehyde dehydrogenase family 1 member A1 ), also named as ALDC, ALDH1 and PUMB1, belongs to the aldehyde dehydrogenase family. The ALDH1A1 gene encodes a liver cytosolic isoform of acetaldehyde dehydrogenase, an enzyme involved in the major pathway of alcohol metabolism after alcohol dehydrogenase. ALDH1A1 plays a critical role in protection against oxidative stress-induced cytotoxicity in lens epithelial cells(PMID:19296407). And it is important for multiple biological activities including drug resistance, cell differentiation, and oxidative stress response(PMID:19025616). As a novel cancer stem cell marker, ALDH1A1 can be used for tumors whose corresponding normal tissues express ALDH1A1 in relatively restricted or limited levels such as breast, lung, ovarian or colon cancer(PMID: 20422001).