CoraLite®594-conjugated AP5Z1/SPG48 Monoclonal antibody

• 

  IF Staining of HEK-293 using CL594-66533

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CoraLite®594 AP5Z1/SPG48 antibody (CL594-66533, Clone: 1G1D7 ) at dilution of 1:100.

AP5Z1/SPG48 Monoclonal Antibody for IF/ICC

Cat No. CL594-66533

Clone No.1G1D7

Host / Isotype

Mouse / IgG1

Reactivity

Human, rat

Applications

IF/ICC

Synonyms

KIAA0415, SPG48

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66533 targets AP5Z1/SPG48 in IF/ICC applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26961

  Product name: Recombinant human KIAA0415 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 260-364 aa of BC037399

  Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV

• Full Name: KIAA0415
• Calculated Molecular Weight: 807 aa, 88 kDa
• Observed Molecular Weight: 88 kDa, 160 kDa
• GenBank Accession Number: BC037399
• Gene Symbol: AP5Z1/SPG48
• Gene ID (NCBI): 9907
• RRID: AB_2920003
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O43299
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

AP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs.