CoraLite® Plus 488-conjugated ARL8B Monoclonal antibody

ARL8B Monoclonal Antibody for WB, FC (Intra)
Cat No. CL488-67891
Clone No.2G10E2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, FC (Intra)

GIE1, EC:3.6.5.2, ARL10C, ADP-ribosylation factor-like protein 8B, ADP-ribosylation factor-like protein 10C

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67891 targets ARL8B in WB, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3711

Product name: Recombinant human ARL8B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-186 aa of BC013131

Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS

Predict reactive species
Full Name ADP-ribosylation factor-like 8B
Calculated Molecular Weight 186 aa, 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC013131
Gene Symbol ARL8B
Gene ID (NCBI) 55207
RRIDAB_2923818
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NVJ2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ARL8B ( ADP-ribosylation factor-like 8B) , also known as ARL10C or GIE1, is a small GTPase of the Arl-family, that is associated with the lysosome. ARL8A interacts with Tubulin, and plays a role in lysosome motility, as well as in chromosomal segregation. ARL8B plays a role in the spatial distribution and positioning of lysosomes. ARL8B is regarded as a regulator of endosome to lysosome trafficking pathways of special significance for host defense.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 ARL8B antibody CL488-67891Download protocol
FC protocol for CL Plus 488 ARL8B antibody CL488-67891Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...