ATG2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATG2A Polyclonal antibody, PBS Only (23226-1-PBS)

• 

  WB analysis using 23226-1-AP (same clone as 23226-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23226-1-AP (ATG2A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23226-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 23226-1-AP (same clone as 23226-1-PBS)

  IP result of anti-ATG2A (IP:23226-1-AP, 4ug; Detection:23226-1-AP 1:4000) with K-562 cells lysate 2400 ug. This data was developed using the same antibody clone with 23226-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 23226-1-AP (same clone as 23226-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23226-1-AP (ATG2A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23226-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 23226-1-AP (same clone as 23226-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23226-1-AP (ATG2A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23226-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 23226-1-AP (same clone as 23226-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using ATG2A antibody (23226-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 23226-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ATG2A Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 23226-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

KIAA0404, Autophagy-related protein 2 homolog A

---

Product Information

23226-1-PBS targets ATG2A in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19709

  Product name: Recombinant human ATG2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 194-539 aa of BC110650

  Sequence: RVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELPAQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQELLSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEI

• Full Name: ATG2 autophagy related 2 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1938 aa, 213 kDa
• Observed Molecular Weight: 215 kDa
• GenBank Accession Number: BC110650
• Gene Symbol: ATG2A
• Gene ID (NCBI): 23130
• RRID: AB_2879235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q2TAZ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Autophagy-related protein 2 homolog A (ATG2A) belongs to the ATG2 family. ATG2A is a lipid transfer protein involved in autophagosome assembly (PMID:31271352). ATG2A tethers the edge of the isolation membrane (IM) to the endoplasmic reticulum (ER) and mediates direct lipid transfer from ER to IM for IM expansion. ATG2A binds to the ER exit site (ERES), which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B) to the IM for membrane expansion (PMID: 30952800, PMID: 31271352). ATG2A also regulates lipid droplet morphology and distribution within the cell (PMID: 28561066). The observed MW of ATG2A is 215 kDa.