CoraLite® Plus 488-conjugated Alpha 2-Antiplasmin Polyclonal antibody

Alpha 2-Antiplasmin Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-28549

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Alpha-2-antiplasmin, Serpin F2, a2-antiplasmin, A2AP, AAP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-28549 targets Alpha 2-Antiplasmin in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29670

Product name: Recombinant human SERPINF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 348-491 aa of BC031592

Sequence: VATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTLELSEVGVEAAAATSIAMSRMSLSSFSVNRPFLFFIFEDTTGLPLFVGSVRNPNPSAPRELKEQQDSPGNKDFLQSLKGFPRGDKLFGPDLKLVPPMEEDYPQFGSPK

Predict reactive species
Full Name serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2
Calculated Molecular Weight 491 aa, 55 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC031592
Gene Symbol Alpha-2-antiplasmin
Gene ID (NCBI) 5345
RRIDAB_3672829
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08697
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SERPINF2, also termed Alpha-2-antiplasmin(a2-AP), a member of the serpin family of serine protease inhibitors. SERPINF2 is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in SERPINF2 result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Alpha 2-Antiplasmin antibody CL488-28549Download protocol
IF protocol for CL Plus 488 Alpha 2-Antiplasmin antibody CL488-28549Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...