CoraLite® Plus 488-conjugated APOH Polyclonal antibody

APOH Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11892

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Apolipoprotein H, Activated protein C-binding protein, Apo H, Apo-H, ApolipoproteinH

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11892 targets APOH in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2500

Product name: Recombinant human APOH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 21-345 aa of BC026283

Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Predict reactive species
Full Name apolipoprotein H (beta-2-glycoprotein I)
Calculated Molecular Weight 345 aa, 38 kDa
Observed Molecular Weight 43-55 kDa
GenBank Accession NumberBC026283
Gene Symbol APOH
Gene ID (NCBI) 350
RRIDAB_3672517
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02749
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins. ApoH is a 54 kDa plasma glycoprotein.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 APOH antibody CL488-11892Download protocol
IF protocol for CL Plus 488 APOH antibody CL488-11892Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...