Use Able AI chat for product recommendations

CoraLite®488-conjugated BCL6 Monoclonal antibody

BCL6 Monoclonal Antibody for FC (Intra)

Cat No. CL488-66340
Clone No.1E6B1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

FC (Intra)

B cell CLL/lymphoma 6, B cell lymphoma 5 protein, B cell lymphoma 6 protein, BCL6, LAZ3, Protein LAZ 3, ZBTB27, Zinc finger protein 51, ZNF51

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inRamos cells
Positive FC detected inRamos cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66340 targets BCL6 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15519

Product name: Recombinant human BCL6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 183-532 aa of BC150184

Sequence: SLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKASKEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEAS

Predict reactive species
Full Name B-cell CLL/lymphoma 6
Calculated Molecular Weight 706 aa, 79 kDa
GenBank Accession NumberBC150184
Gene Symbol BCL6
Gene ID (NCBI) 604
RRIDAB_2919312
Conjugate CoraLite®488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths491 nm / 516 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP41182
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BCl6, a zinc finger transcription factor, contains a N-terminal BTB/POZ domain and C-terminal zinc finger DNA-binding motifs and represses transcription of a wide range of target proteins and microRNAs. BCL6 protein has been reported as a master regulator of B lymphocyte development and growth, and altered BCL6 protein expression was implicated in pathogenesis of diverse human hematologic malignancies, especially in the diffuse large B cell lymphoma (DLBCL). BCL6 is required for the development of T follicular helper T cells (TFH), a helper T cell subset required for the formation of mature and productive GCs. BCL6 has also been shown to play important regulatory roles in macrophages. This antibody only recognize human species.

Protocols

Product Specific Protocols
FC protocol for CL488 BCL6 antibody CL488-66340Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...