CoraLite® Plus 488-conjugated BRPF1 Polyclonal antibody

BRPF1 Polyclonal Antibody for FC (Intra)
Cat No. CL488-30186

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

FC (Intra)

BR140, Bromodomain and PHD finger-containing protein 1, Peregrin, Protein Br140

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-30186 targets BRPF1 in FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32828

Product name: Recombinant human BRPF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 741-880 aa of BC053851

Sequence: QAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTDSAAEESSSQETSKGL

Predict reactive species
Full Name bromodomain and PHD finger containing, 1
Calculated Molecular Weight 1220 aa, 138 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC053851
Gene Symbol BRPF1
Gene ID (NCBI) 7862
RRIDAB_3672844
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55201
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BRPF1 (bromodomain and PHD finger-containing protein 1) is also named as BR140. BRPF1 is scaffold subunit of various histone acetyltransferase (HAT) complexes, such as the MOZ/MORF and HBO1 complexes, which have a histone H3 acetyltransferase activity (PMID:16387653, PMID:24065767, PMID:27939640). BRPF1 plays a key role in HBO1 complex by directing KAT7/HBO1 specificity towards histone H3 'Lys-14' acetylation (H3K14ac) (PMID:24065767). And BRPF1 positively regulates the transcription of RUNX1 and RUNX2 (PMID:18794358).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 BRPF1 antibody CL488-30186Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...