CoraLite® Plus 647 Anti-Mouse BTLA/CD272 Rabbit Recombinant Antibody

BTLA/CD272 Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98246-2
Clone No.242133A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

242133A1, B- and T-lymphocyte attenuator, B- and T-lymphocyte-associated protein, Btla, CD272

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98246-2 targets BTLA/CD272 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1843

Product name: Recombinant Mouse BTLA protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 30-176 aa of AAI08964.1

Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG

Predict reactive species
Full Name B and T lymphocyte associated
Calculated Molecular Weight34kDa
GenBank Accession NumberAAI08964.1
Gene Symbol Btla
Gene ID (NCBI) 208154
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ32MV9
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

BTLA, also known as CD272, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 BTLA/CD272 antibody CL647-98246-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...