FITC Plus Anti-Mouse BTLA/CD272 Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using FITC-98246-2

  1x10^6 mouse splenocytes were surface stained with APC Anti-Mouse CD45R (B220) (RA3-6B2) (APC-65139, Clone: RA3-6B2), and 0.25 ug FITC Plus Anti-Mouse BTLA/CD272 Rabbit RecAb (FITC-98246-2, Clone: 242133A1) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9). Cells were not fixed.

• 

  FC experiment of mouse splenocytes using FITC-98246-2

  1x10^6 mouse splenocytes were surface stained with 0.25 ug FITC Plus Anti-Mouse BTLA/CD272 Rabbit RecAb (FITC-98246-2, Clone: 242133A1) (red) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9) (blue). Cells were not fixed.

BTLA/CD272 Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98246-2

Clone No.242133A1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

242133A1, B- and T-lymphocyte attenuator, B- and T-lymphocyte-associated protein, Btla, CD272

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98246-2 targets BTLA/CD272 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1843

  Product name: Recombinant Mouse BTLA protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 30-176 aa of AAI08964.1

  Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG

• Full Name: B and T lymphocyte associated
• Calculated Molecular Weight: 34kDa
• GenBank Accession Number: AAI08964.1
• Gene Symbol: Btla
• Gene ID (NCBI): 208154
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q32MV9
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

BTLA, also known as CD272, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses.