Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 750-conjugated Beta Tubulin Recombinant monoclonal antibody

Beta Tubulin Uni-rAb® Recombinant Antibody for WB

Cat No. CL750-80713
Clone No.2O13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

WB

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , 2O13

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-80713 targets Beta Tubulin in WB applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0117

Product name: Recombinant human Tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 44-259 aa of BC000748

Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 450 aa, 50 kDa
Observed Molecular Weight50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_3086573
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13509
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.

Protocols

Product Specific Protocols
WB protocol for CL Plus 750 Beta Tubulin antibody CL750-80713Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able™

正在加载,请稍候...