CoraLite®594-conjugated Beta Tubulin Recombinant monoclonal antibody

• 

  IF Staining of C2C12 using CL594-80713

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using CoraLite®594 Beta Tubulin antibody (CL594-80713, Clone: 2O13 ) at dilution of 1:400.

• Featured Product
• KD/KO Validated

Beta Tubulin Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL594-80713

Clone No.2O13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

IF/ICC

Synonyms

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , 2O13

---

Tested Applications

• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-80713 targets Beta Tubulin in IF/ICC applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0117

  Product name: Recombinant human Tubulin-beta protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-259 aa of BC000748

  Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

• Full Name: tubulin, beta 3
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000748
• Gene Symbol: TUBB3
• Gene ID (NCBI): 10381
• RRID: AB_2920195
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Excitation Laser: Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13509
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.