CoraLite® Plus 488-conjugated Beta Tubulin Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-80713

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 Beta Tubulin antibody (CL488-80713, Clone: 2O13 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

Beta Tubulin Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-80713

Clone No.2O13

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

IF/ICC

Synonyms

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , 2O13

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-80713 targets Beta Tubulin in IF/ICC applications and shows reactivity with human, mouse, rat, zebrafish samples.

• Tested Reactivity: human, mouse, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0117

  Product name: Recombinant human Tubulin-beta protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-259 aa of BC000748

  Sequence: LERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVP

• Full Name: tubulin, beta 3
• Calculated Molecular Weight: 450 aa, 50 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000748
• Gene Symbol: TUBB3
• Gene ID (NCBI): 10381
• RRID: AB_3086561
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13509
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.