PE-conjugated Biglycan Monoclonal antibody

• Home
• Products
• Primary Antibodies
• PE-conjugated Biglycan Monoclonal antibody (PE-67275)

• 

  FC experiment of HepG2 using PE-67275

  1x10^6 HepG2 cells were intracellularly stained with 0.1 ug PE-conjugated Biglycan Monoclonal antibody (PE-67275, Clone:1E3F2)(red), or 0.1 ug PE Mouse IgG2a Isotype Control (C1.18.4) (PE-65208, Clone: C1.18.4) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

Biglycan Monoclonal Antibody for FC (Intra)

Cat No. PE-67275

Clone No.1E3F2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

FC (Intra)

Synonyms

BGN, 1E3F2, DSPG1, PG S1, PGI

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-67275 targets Biglycan in FC (Intra) applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8012

  Product name: Recombinant human Biglycan protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-368 aa of BC004244

  Sequence: MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

• Full Name: biglycan
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC004244
• Gene Symbol: Biglycan
• Gene ID (NCBI): 633
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21810
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Biglycan is a member of the small leucine-rich proteoglycan (SLRP) family (PMID: 18463092). It consists of a core protein of 42 kDa containing leucine-rich repeats (LRRs), to which two chondroitin/dermatan sulfate side chains are covalently bound (PMID: 2212616; 10383378). The tissue-specific chondroitin- or dermatan-sulfate glycosaminoglycan chains of biglycan are attached to amino acid residues at the N-terminus of the core protein (PMID: 22821552). Biglycan is a ubiquitous component of connective tissue matrix and may act as a signaling molecule (PMID: 22821552). Upregulation of biglycan has been reported in multiple types of solid cancer (PMID: 32194659).