CoraLite® Plus 647-conjugated CBX3 Monoclonal antibody

CBX3 Monoclonal Antibody for FC (Intra)
Cat No. CL647-66446
Clone No.1A5A3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

FC (Intra)

CBX3, HECH, HP1 gamma, HP1Hs gamma, Modifier 2 protein, 1A5A3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-66446 targets CBX3 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19112

Product name: Recombinant human CBX3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-183 aa of BC000954

Sequence: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ

Predict reactive species
Full Name chromobox homolog 3 (HP1 gamma homolog, Drosophila)
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 22 kDa
GenBank Accession NumberBC000954
Gene Symbol CBX3
Gene ID (NCBI) 11335
RRIDAB_2935054
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13185
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The family of Heterochromatin protein 1 (HP1) proteins is a family of highly conserved heterochromatin-associated non-histone chromosomal proteins , which has important functions in nucleus. These functions include gene activation or repression, regulation of binding of cohesion complexes to centromere, sequestration of genes to nuclear periphery, and heterochromatin formation and propagation. Much evidence shows that HP1 proteins interact with numerous proteins including methylated histones, histone methyltransferases and so on. CBX3 is one of the paralogues of HP1 proteins

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 CBX3 antibody CL647-66446Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...