Anti-Mouse CCL1 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using 98502-2-RR

  1x10^6 HEK-293T cells or CCL1-transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL1 Rabbit RecAb (98502-2-RR, Clone: 250094D6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  FC experiment of Transfected HEK-293T using 98502-2-RR

  1x10^6 HEK-293T cells or CCL1-transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Mouse CCL1 Rabbit RecAb (98502-2-RR, Clone: 250094D6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and APC-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CCL1 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98502-2-RR

Clone No.250094D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

C-C motif chemokine 1, P500, Scya1, SIS-epsilon, Small-inducible cytokine A1

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98502-2-RR targets CCL1 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3293

  Product name: Recombinant Mouse CCL1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 24-92 aa of NM_011329.3

  Sequence: KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC

• Full Name: chemokine (C-C motif) ligand 1
• Calculated Molecular Weight: 10KD
• GenBank Accession Number: NM_011329.3
• Gene Symbol: Ccl1
• Gene ID (NCBI): 20290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10146-1
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CCL1, also known as I-309 in human or TCA-3 in mice, is a small glycoprotein belonging to the CC chemokine family. It is predominantly expressed by activated T cells, monocytes, and endothelial cells, and primarily acts as a chemoattractant for monocytes and T cells. CCL1 binds to the receptor CCR8, which is expressed on monocytes, neutrophils, and T cells, including within the thymus. This chemokine may perform dual functions: as an inflammatory chemokine during leukocyte migration into inflammatory sites and as a constitutive chemokine during T cell selection in the thymus. Furthermore, CCL1 has been associated with allergic inflammation and the recruitment of Th2 cells, suggesting a role in allergic diseases such as asthma.