PE Anti-Mouse CCL1 Rabbit Recombinant Antibody

• 

  FC experiment of Transfected HEK-293T using PE-98502-2

  1x10^6 HEK-293T cells or CCL1-transfected HEK-293T cell were intracellularly stained with 0.1 ug PE Anti-Mouse CCL1 Rabbit RecAb (PE-98502-2, Clone: 250094D6). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  FC experiment of Transfected HEK-293T using PE-98502-2

  1x10^6 HEK-293T cells or CCL1-transfected HEK-293T cells were intracellularly stained with 0.1 ug PE Anti-Mouse CCL1 Rabbit RecAb (PE-98502-2, Clone: 250094D6) (red) or PE Rabbit IgG Isotype Control Recombinant Antibody (PE-98136, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

CCL1 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. PE-98502-2

Clone No.250094D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

Synonyms

C-C motif chemokine 1, P500, Scya1, SIS-epsilon, Small-inducible cytokine A1

---

Tested Applications

• Positive FC (Intra) detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-98502-2 targets CCL1 in FC (Intra) applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3293

  Product name: Recombinant Mouse CCL1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 24-92 aa of NM_011329.3

  Sequence: KSMLTVSNSCCLNTLKKELPLKFIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC

• Full Name: chemokine (C-C motif) ligand 1
• Calculated Molecular Weight: 10KD
• GenBank Accession Number: NM_011329.3
• Gene Symbol: Ccl1
• Gene ID (NCBI): 20290
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Excitation Laser: Blue Laser (488 nm), Green Laser (532 nm), Yellow-Green Laser (561 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10146-1
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CCL1, also known as I-309 in human or TCA-3 in mice, is a small glycoprotein belonging to the CC chemokine family. It is predominantly expressed by activated T cells, monocytes, and endothelial cells, and primarily acts as a chemoattractant for monocytes and T cells. CCL1 binds to the receptor CCR8, which is expressed on monocytes, neutrophils, and T cells, including within the thymus. This chemokine may perform dual functions: as an inflammatory chemokine during leukocyte migration into inflammatory sites and as a constitutive chemokine during T cell selection in the thymus. Furthermore, CCL1 has been associated with allergic inflammation and the recruitment of Th2 cells, suggesting a role in allergic diseases such as asthma.