CoraLite® Plus 488-conjugated CCT6B Monoclonal antibody

• 

  FC experiment of U2OS using CL488-67961

  1X10^6 U2OS cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human CCT6B (CL488-67961, Clone:2F11A9) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

CCT6B Monoclonal Antibody for FC (Intra)

Cat No. CL488-67961

Clone No.2F11A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

CCT zeta 2, CCTZ 2, Cctz2, CCT-zeta-2, CCT-zeta-like

---

Tested Applications

• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67961 targets CCT6B in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31295

  Product name: Recombinant human CCT6B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 231-530 aa of BC027591

  Sequence: LICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK

• Full Name: chaperonin containing TCP1, subunit 6B (zeta 2)
• Calculated Molecular Weight: 530 aa, 58 kDa
• Observed Molecular Weight: 53-58 kDa
• GenBank Accession Number: BC027591
• Gene Symbol: CCT6B
• Gene ID (NCBI): 10693
• RRID: AB_2923840
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92526
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CCT6B, also named as CCT-zeta-2, TCP-1-zeta-like, CCT-zeta-like, Testis-specific Tcp20 and Testis-specific protein TSA303, belongs to the TCP-1 chaperonin family. CCT6B is a molecular chaperone which assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin. CCT6B has 3 isoforms with the molecular mass of 53-58 kDa.