CoraLite® Plus 488-conjugated CCT6B Monoclonal antibody

CCT6B Monoclonal Antibody for FC (Intra)
Cat No. CL488-67961
Clone No.2F11A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

CCT zeta 2, CCTZ 2, Cctz2, CCT-zeta-2, CCT-zeta-like

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67961 targets CCT6B in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31295

Product name: Recombinant human CCT6B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 231-530 aa of BC027591

Sequence: LICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK

Predict reactive species
Full Name chaperonin containing TCP1, subunit 6B (zeta 2)
Calculated Molecular Weight 530 aa, 58 kDa
Observed Molecular Weight53-58 kDa
GenBank Accession NumberBC027591
Gene Symbol CCT6B
Gene ID (NCBI) 10693
RRIDAB_2923840
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92526
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CCT6B, also named as CCT-zeta-2, TCP-1-zeta-like, CCT-zeta-like, Testis-specific Tcp20 and Testis-specific protein TSA303, belongs to the TCP-1 chaperonin family. CCT6B is a molecular chaperone which assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin. CCT6B has 3 isoforms with the molecular mass of 53-58 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CCT6B antibody CL488-67961Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...