CoraLite® Plus 488 Anti-Mouse CD157 Rabbit Recombinant Antibody

• 

  FC experiment of mouse splenocytes using CL488-98213

  1x10^6 mouse splenocytes were surface stained with 0.25 ug APC Anti-Mouse CD3 (17A2) (APC-65077, Clone: 17A2), and 0.25 ug CoraLite® Plus 488 Anti-Mouse CD157 Rabbit RecAb (CL488-98213, Clone: 241822H1) or 0.25 ug CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-98136, Clone: 240953C9). Cells were not fixed.

CD157 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL488-98213

Clone No.241822H1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

241822H1, ADP-ribosyl cyclase 2, ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, Antigen BP3, Bone marrow stromal antigen 1

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98213 targets CD157 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1528

  Product name: Recombinant Mouse CD157 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-286 aa of

  Sequence: ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRES

• Full Name: bone marrow stromal cell antigen 1
• Calculated Molecular Weight: 35kDa
• Gene Symbol: Bst1
• Gene ID (NCBI): 12182
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q64277
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD157, also known as bone marrow stromal cell antigen 1 (BST-1), or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores.