Home
Products
Primary Antibodies
CD3 Polyclonal antibody, PBS Only (17617-1-PBS)

Filter: AllWBIPIHCIF-PIF-Fro

WB analysis of Jurkat using 17617-1-AP (same clone as 17617-1-PBS)
WB result of CD3 antibody (17617-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD3 transfected Jurkat cells. This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
WB analysis using 17617-1-AP (same clone as 17617-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 17617-1-AP (CD3 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
WB analysis using 17617-1-AP (same clone as 17617-1-PBS)
Jurkat cells (CD3+), MOLT-4 cells (CD3+), U-937 cells (CD3-), Raji cells (CD3-), mouse thymus tissue, and rat thymus tissue were subjected to SDS PAGE followed by western blot with 17617-1-AP (CD3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
WB analysis of pig spleen using 17617-1-AP (same clone as 17617-1-PBS)
pig spleen tissue were subjected to SDS PAGE followed by western blot with 17617-1-AP (CD3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IP experiment of Jurkat using 17617-1-AP (same clone as 17617-1-PBS)
IP result of anti-CD3 (IP:17617-1-AP, 4ug; Detection:17617-1-AP 1:1000) with Jurkat cells lysate 3600ug. This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human tonsillitis using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lymphoma using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human angioimmunoblastic T-cell lymphoma using 17617-1-AP (CD3 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lymphoma using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human angioimmunoblastic T-cell lymphoma using 17617-1-AP (CD3 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human pancreas cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of rat thymus using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of rat thymus using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat thymus tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 17617-1-AP (same clone as 17617-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 17617-1-AP (CD3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD3 antibody (17617-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CD20 antibody (60271-1-Ig, Clone: 4A7G3, red). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD3 antibody (17617-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CD20 antibody (60271-1-Ig, Clone: 4A7G3, red). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using CD3 antibody (17617-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse spleen tissue using CD3 antibody (17617-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of human tonsillitis using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD3 antibody (17617-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CD20 antibody (60271-1-Ig, Clone: 4A7G3, red). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.
IF Staining of mouse spleen using 17617-1-AP (same clone as 17617-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse spleen tissue using CD3 antibody (17617-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 17617-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

CD3 Polyclonal antibody, PBS Only

Name: CD3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 17617-1-PBS

CD3 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Cat No. 17617-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA

Synonyms

CD3E, CD3 Epsilon, CD3-epsilon, T3E, T-cell surface antigen T3/Leu-4 epsilon chain

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

17617-1-PBS targets CD3 in WB, IHC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag11797 Product name: Recombinant human CD3E protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-207 aa of BC049847 Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Predict reactive species
Full Name	CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight	207 aa, 23 kDa
Observed Molecular Weight	23-25 kDa
GenBank Accession Number	BC049847
Gene Symbol	CD3
Gene ID (NCBI)	916
ENSEMBL Gene ID	ENSG00000198851
RRID	AB_1939430
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P07766
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a polyclonal antibody directed against the epsilon chain of human CD3 molecule.