• Featured Product
  • KD/KO Validated

CD58 Recombinant monoclonal antibody, PBS Only (Capture)

CD58 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 85950-1-PBS
Clone No.250250H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Ag3, CD58 molecule, LFA 3, LFA3, Lymphocyte function-associated antigen 3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85950-1-PBS targets CD58 as part of a matched antibody pair:

MP02208-1: 85950-1-PBS capture and 85950-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4236

Product name: Recombinant Human CD58 protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 29-215 aa of BC005930

Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR

Predict reactive species
Full Name CD58 molecule
Calculated Molecular Weight 28 kDa
Observed Molecular Weight55-70 kDa
GenBank Accession NumberBC005930
Gene Symbol CD58
Gene ID (NCBI) 965
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19256
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD58, also known as lymphocyte function-associated antigen 3 (LFA-3), is a heavily glycosylated protein of 55-70 kDa that is expressed on a broad range of hematopoietic and non-hematopoietic cells. CD58 is involved in immune recognition of tumor cells via binding of the CD2 receptor expressed on cytotoxic T cells.

Loading...
||
New chat

Able

正在加载,请稍候...