PE-Cyanine7 Anti-Mouse CD80 Rabbit Recombinant Antibody

CD80 Uni-rAb® Recombinant Antibody for FC
Cat No. PY7-98158
Clone No.241371E12

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

241371E12, B7 1, B7.1, Cd28l, CD80 antigen

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse peritoneal macrophages

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.2 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

PY7-98158 targets CD80 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0840

Product name: Recombinant Mouse CD80 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 38-246 aa of NM_009855.2

Sequence: VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKN

Predict reactive species
Full Name CD80 antigen
Calculated Molecular Weight35 kDa
GenBank Accession NumberNM_009855.2
Gene Symbol CD80
Gene ID (NCBI) 12519
Conjugate PE-Cyanine7 Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 778 nm
Excitation LaserBlue Laser (488 nm)/Green Laser (532 nm)/Yellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ00609-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD80 (also known as B7-1) is a type I membrane protein that is a member of the immunoglobulin superfamily, with an extracellular immunoglobulin constant-like domain and a variable-like domain required for receptor binding. It is expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, monocytes, and macrophages. CD80 is the receptor for the proteins CD28 and CTLA-4 found on the surface of T-cells. It is involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28, binding to CTLA-4 has opposite effects and inhibits T-cell activation. CD80 also acts as a cellular attachment receptor for adenovirus subgroup B. (PMID: 7545666; 12015893; 16920215)

Protocols

Product Specific Protocols
FC protocol for PE-Cyanine7 CD80 antibody PY7-98158Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...