CoraLite® Plus 647-conjugated CDC27; APC3 Monoclonal antibody

CDC27; APC3 Monoclonal Antibody for FC (Intra)
Cat No. CL647-67239
Clone No.2F10G2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Mouse, Rat

Applications

FC (Intra)

ANAPC3, APC3, CDC27, CDC27 homolog, CDC27; APC3, CDC27Hs, D0S1430E, D17S978E, H NUC, HNUC

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inK-562 cells
Positive FC detected inK-562 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-67239 targets CDC27; APC3 in FC (Intra) applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25588

Product name: Recombinant human CDC27; APC3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 481-830 aa of BC011656

Sequence: ALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

Predict reactive species
Full Name cell division cycle 27 homolog (S. cerevisiae)
Calculated Molecular Weight 92 kDa
Observed Molecular Weight 90-100 kDa
GenBank Accession NumberBC011656
Gene Symbol CDC27
Gene ID (NCBI) 996
RRIDAB_2935075
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30260
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CDC27/APC3 is a component of the anaphase-promoting complex (APC/cyclosome), which is composed of eight subunits and highly conserved in eukaryotic cells. The APC/cyclosome complex acts as a cell cycle-regulated E3 ubiquitin ligase which mediates ubiquitination and subsequent degradation of target proteins, and lead to the progression control through mitosis and the G1 phase of the cell cycle.

Loading...
||
New chat

Able

正在加载,请稍候...