CoraLite® Plus 488-conjugated Properdin/PFC Monoclonal antibody

Properdin/PFC Monoclonal Antibody for WB
Cat No. CL488-66788
Clone No.1D5A9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB

CFP, 1D5A9, BFD, Complement factor P, complement factor properdin

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66788 targets Properdin/PFC in WB applications and shows reactivity with human, rat, pig samples.

Tested Reactivity human, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9798

Product name: Recombinant human CFP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 120-469 aa of BC015756

Sequence: LEWQLQACEDQQCCPEMGGWSGWGPWEPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL

Predict reactive species
Full Name complement factor properdin
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 50 kDa, 100 kDa, 150 kDa
GenBank Accession NumberBC015756
Gene Symbol CFP
Gene ID (NCBI) 5199
RRIDAB_3084274
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP27918
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CFP, also named as Properdin or PFC, is a 469 amino acid protein, which contains 7 TSP type-1 domains. CFP as secreted protein is a positive regulator of the alternate pathway of complement. It binds to and stabilizes the C3- and C5-convertase enzyme complexes. Properdin deficiency poses a significant risk for severe meningococcal infections (PMID: 22229731). Properdin may be novel biomarker for future risk of type 2 diabetes (PMID: 22338105). In plasma, properdin exists as dimers, trimers or tetramers.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 Properdin/PFC antibody CL488-66788Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...