CHMP2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHMP2A Polyclonal antibody, PBS Only (10477-1-PBS)

• 

  WB analysis of HepG2 using 10477-1-AP (same clone as 10477-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10477-1-AP (CHMP2A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10477-1-AP (same clone as 10477-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10477-1-AP (CHMP2A antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10477-1-AP (same clone as 10477-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10477-1-AP (CHMP2A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10477-1-AP (same clone as 10477-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10477-1-AP (CHMP2A Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10477-1-AP (same clone as 10477-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10477-1-AP (CHMP2A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10477-1-AP (same clone as 10477-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10477-1-AP (CHMP2A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10477-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHMP2A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10477-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CHMP2, chromatin modifying protein 2A, Chromatin-modifying protein 2a, hVps2 1, hVps2-1

---

Product Information

10477-1-PBS targets CHMP2A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0719

  Product name: Recombinant human CHMP2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-220 aa of BC002502

  Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLR

• Full Name: chromatin modifying protein 2A
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC002502
• Gene Symbol: CHMP2A
• Gene ID (NCBI): 27243
• RRID: AB_2079470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43633
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHMP2A, also known as Vps2-1, belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. CHMP2A is a component of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in the degradation of surface receptor proteins and the formation of endocytic multivesicular bodies (MVBs). It has been shown that CHMP2A can interact with and regulate the function of the AAA-ATPase VPS4B (PMID: 15173323). CHMP2A is also reported to be involved in HIV budding (PMID: 21396898; 23051622).