CHSY1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CHSY1 Polyclonal antibody, PBS Only (14420-1-PBS)

• 

  WB analysis of mouse spleen using 14420-1-AP (same clone as 14420-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14420-1-AP (CHSY1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14420-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 14420-1-AP (same clone as 14420-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14420-1-AP (CHSY1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14420-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14420-1-AP (same clone as 14420-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14420-1-AP (CHSY1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 14420-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 14420-1-AP (same clone as 14420-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 14420-1-AP (CHSY1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 14420-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHSY1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14420-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Chondroitin sulfate synthase 1, Chondroitin synthase 1, CHSY, ChSy 1, ChSy-1

---

Product Information

14420-1-PBS targets CHSY1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5766

  Product name: Recombinant human CHSY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 449-802 aa of BC046247

  Sequence: LDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKIQFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPLSGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQILPVSGEFSRALALEVGSSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIFSQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLEDVDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEMWLEKNDPSYSKSSNNNGSVRTA

• Full Name: chondroitin sulfate synthase 1
• Calculated Molecular Weight: 92 kDa
• Observed Molecular Weight: 60-92 kDa
• GenBank Accession Number: BC046247
• Gene Symbol: CHSY1
• Gene ID (NCBI): 22856
• RRID: AB_2079227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86X52
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.