• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CIRBP Polyclonal antibody

CIRBP Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10209

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

CIRP, A18HNRNP, A18 hnRNP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inA549 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10209 targets CIRBP in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0280

Product name: Recombinant human CIRBP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-172 aa of BC000403

Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Predict reactive species
Full Name cold inducible RNA binding protein
Calculated Molecular Weight 172 aa, 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC000403
Gene Symbol CIRBP
Gene ID (NCBI) 1153
RRIDAB_2918963
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14011
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CIRBP, also named as A18HNRNP and CIRP, is a cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival[PMID: 19158277]. CIRBP is also involved in cap-independent translation upon moderate cold-shock. It acts as a translational activator. CIRBP is a suppressive rather stimulatory effect on proliferation[PMID: 19777567]. CIRBP can translocate from nucleus to cytoplasm under stresses such as UV irradation or heat shock. Suppression of CIRBP increased the apoptotic cell population of neural stem cells at moderate low temperature[PMID: 20735994]. This antibody (Catalog# 10209-2-AP) is a rabbit polyclonal antibody raised against the full-length CIRBP of human origin.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CIRBP antibody CL488-10209Download protocol
FC protocol for CL Plus 488 CIRBP antibody CL488-10209Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...