CLTC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CLTC Polyclonal antibody (26523-1-AP)

• Featured Product
• KD/KO Validated

CLTC Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 26523-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

CHC, CHC17, Clathrin heavy chain, Clathrin heavy chain 1, clathrin, heavy chain (Hc)

• 

  WB analysis of HeLa using 26523-1-AP

  WB result of CLTC antibody (26523-1-AP; 1:60000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CLTC transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26523-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 26523-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 26523-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig brain using 26523-1-AP

  pig brain tissue were subjected to SDS PAGE followed by western blot with 26523-1-AP (CLTC Antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 26523-1-AP

  IP result of anti-CLTC (IP:26523-1-AP, 4ug; Detection:26523-1-AP 1:500) with HeLa cells lysate 2500ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 26523-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 26523-1-AP (CLTC antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 26523-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 26523-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26523-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 26523-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26523-1-AP (CLTC Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26523-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CLTC antibody (26523-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26523-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CLTC antibody (26523-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 26523-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human CLTC (26523-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CLTC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HL-60 cells, pig brain tissue, Raji cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon tissue, human breast cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26523-1-AP targets CLTC in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, pig, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25041

  Product name: Recombinant human CLTC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC054489

  Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM

• Full Name: clathrin, heavy chain (Hc)
• Calculated Molecular Weight: 192 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC054489
• Gene Symbol: CLTC
• Gene ID (NCBI): 1213
• RRID: AB_2880542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00610
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. The clathrin molecule has a triskelion shape. Each clathrin triskelion is composed of three identical heavy chains (CLTC) (160-190 kDa) and three light chains of two types, LCA (CLTA) and LCB (CLTB) (30-40 kDa). The heavy chain provides the structural backbone of the clathrin lattice. (PMID: 9133677)

Publications

What published studies show

CLTC Polyclonal antibody (Cat# 26523-1-AP) has accumulated 20 citations across journals including Cell Metabolism, Nature Communications, Autophagy, Advanced Science, Oncogene, Journal of Biological Chemistry, and FASEB Journal. The research fields encompass clathrin-mediated endocytosis, membrane trafficking, neurodegeneration, cancer immunology, viral pathogenesis, autophagy, wound repair, and cardiovascular disease.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Metab; Oral GLP-1 receptor agonist promotes astrocyte-neuron lactate and lipid transfer with neuroprotective effects.; Authors - Yixuan Du
human	WB	Autophagy; AP2M1 mediates autophagy-induced CLDN2 (claudin 2) degradation through endocytosis and interaction with LC3 and reduces intestinal epithelial tight junction permeability.; Authors - Ashwinkumar Subramenium Ganapathy
mouse	WB	Nat Commun; CD276-dependent efferocytosis by tumor-associated macrophages promotes immune evasion in bladder cancer; Authors - Maosheng Cheng
		Adv Sci (Weinh); Tumor Extracellular Vesicles Aggravate Mitochondrial Damage in Myocardial Ischemia/Reperfusion Injury; Authors - Zhongting Mei
mouse	WB,IF	Adv Sci (Weinh); Intermediate Filament Protein BFSP2 Controls Spindle Formation via HSC70-Mediated Stabilization of CLTC During Oocyte meiosis; Authors - Yu Li
human	IF	Adv Sci (Weinh); Membrane Tension Regulation is Required for Wound Repair; Authors - Nikita Raj