CMTM8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CMTM8 Polyclonal antibody, PBS Only (15039-1-PBS)

• 

  WB analysis of mouse bladder using 15039-1-AP (same clone as 15039-1-PBS)

  mouse bladder tissue were subjected to SDS PAGE followed by western blot with 15039-1-AP (CMTM8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 15039-1-AP (same clone as 15039-1-PBS)

  IP result of anti-CMTM8 (IP:15039-1-AP, 4ug; Detection:15039-1-AP 1:300) with mouse liver tissue lysate 6800ug. This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 15039-1-AP (same clone as 15039-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15039-1-AP (CMTM8 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15039-1-PBS in a different storage buffer formulation.

CMTM8 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15039-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Chemokine-like factor superfamily member 8, CKLF-like MARVEL transmembrane domain-containing protein 8, CKLFSF8

---

Product Information

15039-1-PBS targets CMTM8 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6776

  Product name: Recombinant human CMTM8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-173 aa of BC041390

  Sequence: MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLHGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVSYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ

• Full Name: CKLF-like MARVEL transmembrane domain containing 8
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC041390
• Gene Symbol: CMTM8
• Gene ID (NCBI): 152189
• RRID: AB_10949191
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CMTM8, also known as CKLFSF8, is a member of the chemokine-like factor superfamily (CKLFSF). Proteins of this family share similarity with both the chemokine and the transmembrane 4 superfamilies. CMTM8 is an attenuator of EGF-induced signaling (PMID: 16263120). Overexpression of CMTM8 accelerates ligand-induced clearance of EGFR from the cell surface and induces apoptosis via caspase-dependent and -independent pathways (PMID: 17149703). An alternative splice form of CMTM8, CMTM8-v2, arises from a deletion of exon 2. CMTM8-v2 maintains the ability to induce apoptosis (PMID: 17681841).