CPNE3 Recombinant monoclonal antibody

• 

  WB analysis using 83820-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83820-5-RR (CPNE3 antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 83820-5-RR

  WB result of CPNE3 antibody (83820-5-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CPNE3 transfected A431 cells.

• 

  IP experiment of HepG2 using 83820-5-RR

  IP result of anti-CPNE3 (IP:83820-5-RR, 4ug; Detection:83820-5-RR 1:2000) with HepG2 cells lysate 1600 ug.

• 

  IF Staining of A431 using 83820-5-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CPNE3 antibody (83820-5-RR, Clone: 240871E5 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 83820-5-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug CPNE3 Recombinant antibody (83820-5-RR, Clone:240871E5) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83820-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83820-5-RR against Human CPNE3 were performed. The affinity constant is below 1 pM.

• Featured Product
• KD/KO Validated

CPNE3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 83820-5-RR

Clone No.240871E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

Synonyms

240871E5, Copine 3, Copine III, Copine-3, copineIII

---

Tested Applications

• Positive WB detected in: Y79 cells, A431 cells, HepG2 cells, A549 cells, HeLa cells, HuH-7 cells
• Positive IP detected in: HepG2 cells
• Positive IF/ICC detected in: A431 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:14000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83820-5-RR targets CPNE3 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1634

  Product name: Recombinant human CPNE3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 238-537 aa of BC036242

  Sequence: EASRSSPVEFECINEKKRQKKKSYKNSGVISVKQCEITVECTFLDYIMGGCQLNFTVGVDFTGSNGDPRSPDSLHYISPNGVNEYLTALWSVGLVIQDYDADKMFPAFGFGAQIPPQWQVSHEFPMNFNPSNPYCNGIQGIVEAYRSCLPQIKLYGQTNFSPIINHVARFAAAATQQQTASRYFVLLIITDGVITDLDETRQAIVNASRLPMSIIIVGVGGADFSAMEFLDGDGGSLHSPLGEVAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ

• Full Name: copine III
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC036242
• Gene Symbol: CPNE3
• Gene ID (NCBI): 8895
• RRID: AB_3671405
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O75131
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Copines are a family of evolutionarily conserved calcium-dependent phospholipid-binding proteins (PMID: 9430674). They contain two Ca(2+)- and phospholipid-binding domains known as C2 domains. Copines are potentially involved in regulating membrane trafficking and in protein-protein interactions. Copine III (CPNE3) has also been identified as a ligand of ERBB2 and plays an important role in various carcinogenesis. The high expression of CPNE3 is an adverse prognostic biomarker for acute myeloid leukemia (PMID: 28670859).