CTHRC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CTHRC1 Polyclonal antibody, PBS Only (16534-1-PBS)

• 

  WB analysis using 16534-1-AP (same clone as 16534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16534-1-AP (CTHRC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16534-1-AP (same clone as 16534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16534-1-AP (CTHRC1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• 

  IP experiment of A375 using 16534-1-AP (same clone as 16534-1-PBS)

  IP result of anti-CTHRC1 (IP:16534-1-AP, 3ug; Detection:16534-1-AP 1:500) with A375 cells lysate 3600ug. This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 16534-1-AP (same clone as 16534-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using CTHRC1 antibody (16534-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16534-1-AP (same clone as 16534-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CTHRC1 antibody (16534-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A375 using 16534-1-AP (same clone as 16534-1-PBS)

  1x10^6 A375 cells were intracellularly stained with 0.13 ug CTHRC1 Polyclonal antibody (16534-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.13 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 16534-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CTHRC1 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 16534-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

collagen triple helix repeat containing 1, Collagen triple helix repeat-containing protein 1, Protein NMTC1, UNQ762/PRO1550

---

Product Information

16534-1-PBS targets CTHRC1 in WB, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9812

  Product name: Recombinant human CTHRC1 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-243 aa of BC014245

  Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

• Full Name: collagen triple helix repeat containing 1
• Calculated Molecular Weight: 243 aa, 26 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC014245
• Gene Symbol: CTHRC1
• Gene ID (NCBI): 115908
• RRID: AB_2087511
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CG8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Collagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095).