CoraLite®594-conjugated CYP27A1 Monoclonal antibody

• 

  IF Staining of human liver cancer using CL594-67045

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite®594 CYP27A1 antibody (CL594-67045, Clone: 3G3F7 ) at dilution of 1:200.

• 

  IF Staining of human liver cancer using CL594-67045

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite®594 CYP27A1 antibody (CL594-67045, Clone: 3G3F7 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CYP27A1 Monoclonal Antibody for IF-P

Cat No. CL594-67045

Clone No.3G3F7

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF-P

Synonyms

CP27, CTX, CYP27, CYP27A1, Cytochrome P 450C27/25, Cytochrome P450 27, Sterol 27 hydroxylase, Vitamin D(3) 25 hydroxylase

---

Tested Applications

• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67045 targets CYP27A1 in IF-P applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7746

  Product name: Recombinant human CYP27A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 183-531 aa of BC051851

  Sequence: DDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC

• Full Name: cytochrome P450, family 27, subfamily A, polypeptide 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC051851
• Gene Symbol: CYP27A1
• Gene ID (NCBI): 1593
• RRID: AB_2920079
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q02318
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.