CoraLite®594-conjugated Calpastatin Monoclonal antibody

• 

  IF Staining of HeLa using CL594-67107

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 Calpastatin antibody (CL594-67107, Clone: 1G12A2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL594-67107

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human Calpastatin (CL594-67107, Clone:1G12A2) (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Calpastatin Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL594-67107

Clone No.1G12A2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF/ICC, FC (Intra)

Synonyms

BS 17, Calpain inhibitor, calpastatin, CAST, Sperm BS 17 component

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67107 targets Calpastatin in IF/ICC, FC (Intra) applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28669

  Product name: Recombinant human CAST protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC013579

  Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK

• Full Name: calpastatin
• Calculated Molecular Weight: 667 aa, 72 kDa
• Observed Molecular Weight: 115 kDa
• GenBank Accession Number: BC013579
• Gene Symbol: Calpastatin
• Gene ID (NCBI): 831
• RRID: AB_3084747
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P20810
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.