CoraLite® Plus 488-conjugated Calpastatin Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67107

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 Calpastatin antibody (CL488-67107, Clone: 1G12A2 ) at dilution of 1:200.

• 

  FC experiment of HeLa using CL488-67107

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated Calpastatin Monoclonal antibody (CL488-67107, Clone:1G12A2)(red), or 0.8 ug CoraLite® Plus 488 Mouse IgG1 Isotype Control (1F8D3) (CL488-66360-1, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

Calpastatin Monoclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-67107

Clone No.1G12A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

Synonyms

CAST, Sperm BS-17 component, Calpain inhibitor, 1G12A2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67107 targets Calpastatin in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28669

  Product name: Recombinant human CAST protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC013579

  Sequence: MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEK

• Full Name: calpastatin
• Calculated Molecular Weight: 667 aa, 72 kDa
• GenBank Accession Number: BC013579
• Gene Symbol: Calpastatin
• Gene ID (NCBI): 831
• RRID: AB_2919421
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P20810
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.