CoraLite® Plus 488-conjugated Caspase 7 Monoclonal antibody

Caspase 7 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67956
Clone No.3C9H4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

FC (Intra)

CASP7, 3C9H4, Apoptotic protease Mch 3, Apoptotic protease Mch-3, CASP 7

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67956 targets Caspase 7 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27601

Product name: Recombinant human Caspase 7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-100 aa of BC015799

Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC

Predict reactive species
Full Name caspase 7, apoptosis-related cysteine peptidase
Calculated Molecular Weight 303 aa, 34 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC015799
Gene Symbol Caspase 7
Gene ID (NCBI) 840
RRIDAB_2934598
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55210
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Caspase 7 antibody CL488-67956Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...