CoraLite®594-conjugated Centrin 1 Polyclonal antibody

• 

  IF Staining of hTERT-RPE1 using CL594-12794

  Immunofluorescent analysis of (-20°C Methanol) fixed hTERT-RPE1 cells using CoraLite®594 Centrin 1 antibody (CL594-12794) at dilution of 1:200.

• 

  IF Staining of HeLa using CL594-12794

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite®594 Centrin 1 antibody (CL594-12794) at dilution of 1:200.

Centrin 1 Polyclonal Antibody for IF/ICC

Cat No. CL594-12794

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CETN1, CETN, Centrin-1, CEN1, Caltractin isoform 2

---

Tested Applications

• Positive IF/ICC detected in: hTERT-RPE1 cells, HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-12794 targets Centrin 1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3529

  Product name: Recombinant human CETN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC029515

  Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 1
• Calculated Molecular Weight: 172 aa, 20 kDa
• GenBank Accession Number: BC029515
• Gene Symbol: Centrin 1
• Gene ID (NCBI): 1068
• RRID: AB_2919788
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Antigen Affinity Purified
• UNIPROT ID: Q12798
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.