CoraLite® Plus 488-conjugated Complement factor B Monoclonal antibody

Complement factor B Monoclonal Antibody for IF-P
Cat No. CL488-66154
Clone No.8D2B6

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

IF-P

BF, BFD, C3/C5 convertase, CFAB, CFB, complement factor B, FB, FBI12, GBG, Glycine rich beta glycoprotein, H2 Bf, PBF2, Properdin factor B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver tissue

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66154 targets Complement factor B in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgM
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19107

Product name: Recombinant human CFB protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 574-762 aa of BC007990

Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG

Predict reactive species
Full Name complement factor B
Calculated Molecular Weight 86 kDa
Observed Molecular Weight 93 kDa
GenBank Accession NumberBC007990
Gene Symbol Complement factor B
Gene ID (NCBI) 629
RRIDAB_2934449
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodThiophilic affinity chromatograph
UNIPROT IDP00751
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is cleaved into Ba and Bb by factor D in the presence of C3b. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Complement factor B antibody CL488-66154Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...