DNASE1L3 Monoclonal antibody

DNASE1L3 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67041-1-Ig
Clone No.1A4D4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, ELISA

1A4D4, Deoxyribonuclease gamma, Deoxyribonuclease I-like 3, DHP2, DNAS1L3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, U2OS cells, Daudi cells, A431 cells, LnCaP cells, Jurkat cells, K-562 cells, HepG2 cells, Raji cells
Positive IHC detected inmouse liver tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67041-1-Ig targets DNASE1L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28187

Product name: Recombinant human DNASE1L3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-305 aa of BC015831

Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Predict reactive species
Full Name deoxyribonuclease I-like 3
Calculated Molecular Weight 305 aa, 36 kDa
Observed Molecular Weight 33-38 kDa
GenBank Accession NumberBC015831
Gene Symbol DNASE1L3
Gene ID (NCBI) 1776
RRIDAB_2882355
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Deoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+/Mg2+- dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences (PMID:157967140). It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3′-OH/5′-P ends, which is Ca2+/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin (PMID:9665719). In addition, it translocates from the endoplasmic reticulum to the nucleus during apoptosis (PMID: 23229555). DNASE1L3 can be located either in the cytoplasm or in the nucleus.

Protocols

Product Specific Protocols
IHC protocol for DNASE1L3 antibody 67041-1-IgDownload protocol
WB protocol for DNASE1L3 antibody 67041-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Aging (Albany NY)

Deoxyribonuclease 1-like 3 may be a potential prognostic biomarker associated with immune infiltration in colon cancer.

Authors - Jing Liu
humanWB

Cancer Lett

Multi-omics analysis of polyamine metabolism implicates NT5E/CD73 in the progression of pancreatic cancer

Authors - Enkui Zhang
humanWB,IHC

J Transl Med

Prognostic implications and characterization of tumor-associated tertiary lymphoid structures genes in pancreatic cancer

Authors - Enkui Zhang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tsz Tung (Verified Customer) (04-28-2022)

Work for mouse tumor-bearing liver FFPE-processed tissue (Red: DNase1L3)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse liver FFPE
DNASE1L3 Antibody Immunofluorescence validation (1:100 dilution) in Mouse liver FFPE (Cat no:67041-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...