DUSP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DUSP3 Polyclonal antibody, PBS Only (28284-1-PBS)

• 

  WB analysis using 28284-1-AP (same clone as 28284-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28284-1-AP (DUSP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28284-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 28284-1-AP (same clone as 28284-1-PBS)

  WB result of DUSP3 antibody (28284-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-DUSP3 transfected HeLa cells. This data was developed using the same antibody clone with 28284-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28284-1-AP (same clone as 28284-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28284-1-AP (DUSP3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28284-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DUSP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28284-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

VHR, Vaccinia H1-related phosphatase, EC:3.1.3.16, dual specificity phosphatase 3

---

Product Information

28284-1-PBS targets DUSP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28575

  Product name: Recombinant human DUSP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-185 aa of BC002682

  Sequence: MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP

• Full Name: dual specificity phosphatase 3
• Calculated Molecular Weight: 185 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC002682
• Gene Symbol: DUSP3
• Gene ID (NCBI): 1845
• RRID: AB_2918154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51452
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.