CoraLite® Plus 488-conjugated Destrin Monoclonal antibody

Destrin Monoclonal Antibody for FC (Intra)
Cat No. CL488-67657
Clone No.1A12D9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

FC (Intra)

DSTN, 1A12D9, ACTDP, Actin-depolymerizing factor, ADF

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67657 targets Destrin in FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1402

Product name: Recombinant human DSTN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-165 aa of BC009477

Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV

Predict reactive species
Full Name destrin (actin depolymerizing factor)
Calculated Molecular Weight 19 kDa
Observed Molecular Weight18-19 kDa
GenBank Accession NumberBC009477
Gene Symbol Destrin
Gene ID (NCBI) 11034
RRIDAB_2923779
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP60981
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Destrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 Destrin antibody CL488-67657Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...