CoraLite® Plus 488-conjugated EIF3D Recombinant monoclonal antibody

• 

  IF Staining of U2OS using CL488-82512

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CoraLite® Plus 488 EIF3D antibody (CL488-82512, Clone: 3O8 ) at dilution of 1:200.

• 

  FC experiment of U2OS using CL488-82512

  1x10^6 U2OS cells were intracellularly stained with 0.4 ug CoraLite® Plus 488-conjugated EIF3D Recombinant antibody (CL488-82512, Clone:3O8)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

EIF3D Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82512

Clone No.3O8

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, FC (Intra)

Synonyms

3O8, eIF 3 zeta, eIF3 p66, eIF3 zeta, EIF3S7

---

Tested Applications

• Positive IF/ICC detected in: U2OS cells
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82512 targets EIF3D in IF/ICC, FC (Intra) applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0268

  Product name: Recombinant human EIF3D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-531 aa of BC000328

  Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE

• Full Name: eukaryotic translation initiation factor 3, subunit D
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC000328
• Gene Symbol: EIF3D
• Gene ID (NCBI): 8664
• RRID: AB_3673067
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15371
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.