EIF3L Monoclonal antibody, PBS Only

• 

  WB analysis using 67719-1-Ig (same clone as 67719-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67719-1-Ig (EIF3L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67719-1-Ig (same clone as 67719-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67719-1-Ig (EIF3L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 67719-1-Ig (same clone as 67719-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67719-1-Ig (EIF3L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 67719-1-Ig (same clone as 67719-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67719-1-Ig (EIF3L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pancreas using 67719-1-Ig (same clone as 67719-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pancreas using 67719-1-Ig (same clone as 67719-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67719-1-Ig (same clone as 67719-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67719-1-Ig (same clone as 67719-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human EIF3L (67719-1-Ig, Clone:1B11A10) and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 67719-1-PBS in a different storage buffer formulation.

EIF3L Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Cat No. 67719-1-PBS

Clone No.1B11A10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA

Synonyms

Eukaryotic translation initiation factor 3 subunit E-interacting protein, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, EIF3S6IP, EIF3S11, EIF3EIP

---

Product Information

67719-1-PBS targets EIF3L in WB, IHC, IF/ICC, IF-P, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26680

  Product name: Recombinant human EIF3L protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 255-564 aa of BC007510

  Sequence: SVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP

• Full Name: eukaryotic translation initiation factor 3, subunit L
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC007510
• Gene Symbol: EIF3L
• Gene ID (NCBI): 51386
• RRID: AB_2882907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y262
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.