EIF3L Monoclonal antibody

• Home
• Products
• Primary Antibodies
• EIF3L Monoclonal antibody (67719-1-Ig)

• KD/KO Validated

EIF3L Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 67719-1-Ig Copied!

Clone No. 1B11A10

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

1B11A10, EIF3EIP, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein

• 

  WB analysis using 67719-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67719-1-Ig (EIF3L antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67719-1-Ig

  WB result of EIF3L antibody (67719-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF3L transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67719-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67719-1-Ig (EIF3L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 67719-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67719-1-Ig (EIF3L antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse pancreas using 67719-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67719-1-Ig (EIF3L antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse pancreas using 67719-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse pancreas using 67719-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse pancreas tissue using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 67719-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using EIF3L antibody (67719-1-Ig, Clone: 1B11A10 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 67719-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human EIF3L (67719-1-Ig, Clone:1B11A10) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF3L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, LNCaP cells, PC-12 cells, 4T1 cells
• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse pancreas tissue
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67719-1-Ig targets EIF3L in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26680

  Product name: Recombinant human EIF3L protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 255-564 aa of BC007510

  Sequence: SVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP

• Full Name: eukaryotic translation initiation factor 3, subunit L
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 61 kDa, 67 kDa
• GenBank Accession Number: BC007510
• Gene Symbol: EIF3L
• Gene ID (NCBI): 51386
• RRID: AB_2882907
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y262
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The EIF3L Monoclonal antibody (1B11A10), catalog number 67719-1-Ig, has a total of 1 citation. It appears in PLoS Biology, where it was used to study stress granule formation during RNA virus infections, specifically examining virus-specific differences in their generation and composition. The associated research field is virology and cellular stress response.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		PLoS Biol; Stress granules formed during infections with RNA viruses have significant virus-specific differences in generation and composition.; Authors - Reto M. Lang