EPHB1 Monoclonal antibody, PBS Only (Detector)

EPHB1 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 67080-1-PBS
Clone No.1B7C12

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

EPH receptor B1, EPH like kinase 6, ELK, EK6, EC:2.7.10.1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67080-1-PBS targets EPHB1 as part of a matched antibody pair:

MP50740-1: 67080-2-PBS capture and 67080-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16347

Product name: Recombinant human EPHB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 247-371 aa of BC111744

Sequence: MVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCS

Predict reactive species
Full Name EPH receptor B1
Calculated Molecular Weight 984 aa, 110 kDa
Observed Molecular Weight 110-120 kDa
GenBank Accession NumberBC111744
Gene Symbol EPHB1
Gene ID (NCBI) 2047
RRIDAB_2882388
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54762
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EPHB1, also named as EPHT2, NET, HEK6 and ELK, belongs to the protein kinase superfamily, Tyr protein kinase family, and Ephrin receptor subfamily. It is a receptor for members of the ephrin-B family. EPHB1 binds to ephrin-B1, -B2 and -B3. EPHB1 may be involved in cell-cell interactions in the nervous system. EPHB1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Loading...
||
New chat Able
正在加载,请稍候...