CoraLite® Plus 488-conjugated FAM114A1 Polyclonal antibody

FAM114A1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-21638

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Protein NOXP20, Protein FAM114A1, NOXP20, Nervous system overexpressed protein 20

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21638 targets FAM114A1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16287

Product name: Recombinant human FAM114A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 305-538 aa of BC040452

Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI

Predict reactive species
Full Name family with sequence similarity 114, member A1
Calculated Molecular Weight 563 aa, 61 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC040452
Gene Symbol FAM114A1
Gene ID (NCBI) 92689
RRIDAB_3672734
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8IWE2
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FAM114A1 antibody CL488-21638Download protocol
FC protocol for CL Plus 488 FAM114A1 antibody CL488-21638Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...