CoraLite® Plus 488-conjugated FAM114A1 Polyclonal antibody

• 

  IF Staining of HepG2 using CL488-21638

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 FAM114A1 antibody (CL488-21638) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-21638

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488-conjugated FAM114A1 Polyclonal antibody (CL488-21638)(red), or 0.4 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

FAM114A1 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-21638

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

Synonyms

Protein NOXP20, Protein FAM114A1, NOXP20, Nervous system overexpressed protein 20

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-21638 targets FAM114A1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16287

  Product name: Recombinant human FAM114A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-538 aa of BC040452

  Sequence: LEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENEENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLTTAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYI

• Full Name: family with sequence similarity 114, member A1
• Calculated Molecular Weight: 563 aa, 61 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC040452
• Gene Symbol: FAM114A1
• Gene ID (NCBI): 92689
• RRID: AB_3672734
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWE2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FAM114A1, also named as Nervous system overexpressed protein 20, is a 563 amino acid protein, which belongs to the FAM114 family. FAM114A1 localizes in the cytoplasm and may play a role in neuronal cell development. The calculated molecular weight of FAM114A1 is 61 kDa, but the modified FAM114A1 may be 70-80 kDa protein.