• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FDX1 Recombinant monoclonal antibody

FDX1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82957
Clone No.230196B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

TMEM79, 230196B12, 230487H5, ADX, FDX

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inA431 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82957 targets FDX1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3301

Product name: Recombinant human FDX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-184 aa of BC017063

Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Predict reactive species
Full Name ferredoxin 1
Calculated Molecular Weight 184 aa, 19 kDa
Observed Molecular Weight14 kDa
GenBank Accession NumberBC017063
Gene Symbol FDX1
Gene ID (NCBI) 2230
RRIDAB_3673151
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10109
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FDX1 antibody CL488-82957Download protocol
IF protocol for CL Plus 488 FDX1 antibody CL488-82957Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...