CoraLite® Plus 488-conjugated FIS1 Recombinant monoclonal antibody

FIS1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-82248
Clone No.6N15

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

6N15, CGI 135, CGI-135, FIS1 homolog, hFis1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82248 targets FIS1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1409

Product name: Recombinant human FIS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC009428

Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Predict reactive species
Full Name fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Calculated Molecular Weight 17 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC009428
Gene Symbol FIS1
Gene ID (NCBI) 51024
RRIDAB_3084512
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y3D6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (PMID: 21257639, 21459773, 23333625)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FIS1 antibody CL488-82248Download protocol
IF protocol for CL Plus 488 FIS1 antibody CL488-82248Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...