CoraLite® Plus 488-conjugated FIS1 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-82248

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 FIS1 antibody (CL488-82248, Clone: 6N15 ) at dilution of 1:200.

• 

  FC experiment of HepG2 using CL488-82248

  1X10^6 HepG2 cells were intracellularly stained with 0.8 ug CoraLite® Plus 488 Anti-Human FIS1 (CL488-82248, Clone:6N15) (red), or 0.8 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

FIS1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra)

Cat No. CL488-82248

Clone No.6N15

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

TPR repeat protein 11, hFis1, FIS1 homolog, CGI-135, CGI 135

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-82248 targets FIS1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1409

  Product name: Recombinant human FIS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC009428

  Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

• Full Name: fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC009428
• Gene Symbol: FIS1
• Gene ID (NCBI): 51024
• RRID: AB_3084512
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3D6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (PMID: 21257639, 21459773, 23333625)